General Information

  • ID:  hor005458
  • Uniprot ID:  P05623(20-55)
  • Protein name:  Accessory gland-specific peptide 70A
  • Gene name:  SP
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Drosophila sex peptide family
  • Source:  animal
  • Expression:  No expression in females or embryos . |Main cells of the accessory glands of males (paragonial gland).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007557 regulation of juvenile hormone biosynthetic process; GO:0007610 behavior; GO:0007621 negative regulation of female receptivity; GO:0008343 adult feeding behavior; GO:0019953 sexual reproduction; GO:0044703 multi-organism reproductive process; GO:0045434 negative regulation of female receptivity, post-mating; GO:0046008 regulation of female receptivity, post-mating; GO:0046662 regulation of egg-laying behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  WEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC
  • Length:  36(20-55)
  • Propeptide:  MKTLALFLVLVCVLGLVQSWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC
  • Signal peptide:  MKTLALFLVLVCVLGLVQS
  • Modification:  T9 Hydroxyproline;T13 Hydroxyproline;T14 Isoleucine derivative;T15 Hydroxyproline;T17 Hydroxyproline;T19 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  7-8RK->QQ: Abolishes cleavage from sperm and prevents release of C-terminal fragment for long-term PMR. Short-term PMR in unaffected.; 23-23RK->QQ: Abolishes cleavage from sperm and prevents release of C-terminal fragment for long-term PMR. Short-term PMR

Activity

  • Function:  Male seminal protein which triggers short- and long-term post-mating behavioral responses (PMR) in female Drosophila. Binds initially to sperm where it is later cleaved to release an active peptide within the female reproductive tract. Signals via the sex
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  24-36
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005458_AF2.pdbhor005458_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 497248 Formula: C202H293N59O46S2
Absent amino acids: HMQVY Common amino acids: P
pI: 11.02 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -121.94 Boman Index: -8117
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 35.28
Instability Index: 2883.06 Extinction Coefficient cystines: 27625
Absorbance 280nm: 789.29

Literature

  • PubMed ID:  3135120
  • Title:  A male accessory gland peptide that regulates reproductive behavior of female D. melanogaster.